PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0122s0053.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 403aa    MW: 44630.9 Da    PI: 6.5104
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0122s0053.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY955.3e-3096153260
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           DgynWrKYGqK+vkg efprsYY+Ct+++C+vkk +er++ d++++e++Y+g+H h+k
  Kalax.0122s0053.2.p  96 TDGYNWRKYGQKHVKGCEFPRSYYKCTHPNCEVKKLLERNH-DGRITEVIYKGTHAHPK 153
                          6***************************************9.***************85 PP

2WRKY102.52.4e-32259317159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct agCpv+k+ver+ +d k v++tYeg+Hnh+
  Kalax.0122s0053.2.p 259 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCPVRKHVERACHDIKSVITTYEGKHNHD 317
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-2688154IPR003657WRKY domain
PROSITE profilePS5081122.37890154IPR003657WRKY domain
SuperFamilySSF1182901.16E-2393154IPR003657WRKY domain
SMARTSM007741.2E-3195153IPR003657WRKY domain
PfamPF031063.0E-2397152IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.7E-37244319IPR003657WRKY domain
SuperFamilySSF1182908.89E-29251319IPR003657WRKY domain
PROSITE profilePS5081138.262254319IPR003657WRKY domain
SMARTSM007741.6E-36259318IPR003657WRKY domain
PfamPF031065.9E-25260317IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MLGGVGYAAA ASTSYANNSA CVGKISDNSE FGTQSQSNFA TGSSLLPSQA FPVTESQQYE  60
LQSQHIEGEK AIQYATASPP DQNEVRLSAV SDNSSTDGYN WRKYGQKHVK GCEFPRSYYK  120
CTHPNCEVKK LLERNHDGRI TEVIYKGTHA HPKPQSKRRF PNDSVMGTTD EHLERFSYQS  180
EEMALGASAA TPDMDGTSEF PSGPPSDEEL NDDKYDDDGD DPNSKRRKQD MGVVHFISSV  240
KPIREPRVVV QTVSEVDILD DGYRWRKYGQ KVVKGNPNPR SYYKCTNAGC PVRKHVERAC  300
HDIKSVITTY EGKHNHDVPA AKSNNQEASA AAVDPFSSYT ANMGSSSVMQ NDSVTQVSAR  360
YQLPPNFRNQ YPDNEGENFR FATPYLSSNA YPQNLRSLQM GP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-3697320878Probable WRKY transcription factor 4
2lex_A1e-3697320878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010644520.11e-107PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV01e-98WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLF6HER41e-107F6HER4_VITVI; Putative uncharacterized protein
STRINGVIT_19s0090g01720.t011e-107(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.12e-96WRKY family protein